Contact-us on : info@isoroid.com

LAST ADDED

Domain Link Count Meta Count Script Count Link
mordi.com 1 1 0 GO
mordhorstlaw.com 8 15 25 GO
mordhorst-hamburg.de 6 14 6 GO
mordheimsite.com 0 0 0 GO
mordheimfrance.com 29 17 25 GO
mordheimer.com 0 0 0 GO
mordheim-cityofthedamned.com 19 26 20 GO
mordheimcampaign.blogspot.com 11 35 11 GO
mordhaus.sk 3 2 3 GO
mordgpi.ru 6 5 22 GO
mordgeld.com 0 12 0 GO
mordfustang.com 1 11 0 GO
mordfin.com 5 11 12 GO
mordfall-angelika-foeger-graen.com 3 9 5 GO
mordex-sportswear.de 53 25 27 GO
mordexsmolensk.ru 3 2 7 GO
mordex.pl 0 0 0 GO
mordex.by 5 3 7 GO
mordewind.pl 0 1 1 GO
mordesigns.com 6 1 12 GO
mordernjewel.blogspot.com 11 7 37 GO
mordern.com.tw 2 4 3 GO
morderer.com.ua 0 3 0 GO
morderelpolvo.com 0 0 0 GO
mordere-che.blogspot.com 10 33 11 GO
mordeo.com.au 2 4 13 GO
morden-weather.com 0 0 0 GO
mordentower.com 6 1 12 GO
mordentourism.com 25 18 47 GO
mordentmusic.com 0 0 0 GO
mordentimes.com 3 12 34 GO
mordentimes.ca 3 12 34 GO
mordentelaw.com 13 9 20 GO
mordent.com 18 11 27 GO
mordensports.co.uk 0 0 0 GO
mordensorganicfarmstore.com 1 4 0 GO
mordenservicentre.com 22 16 8 GO
mordensafegrad.com 0 0 0 GO
mordens.net 0 0 0 GO
mordenrealty.com 27 4 32 GO
mordenpropertygazette.co.uk 10 180 26 GO
mordeno.com 6 4 8 GO
mordennurseries.com 15 13 22 GO
mordenminorsoccer.com 29 11 32 GO
mordenminorhockey.com 1 3 10 GO
mordenmb.net 27 7 36 GO
mordenmb.com 26 7 36 GO
mordenmb.ca 27 7 36 GO
mordenmartialarts.co.uk 7 16 20 GO
mordenlake.com 1 1 3 GO
mordenhomehardware.ca 0 0 0 GO
mordenhillsurgery.co.uk 17 10 7 GO
mordenhallparkanglingclub.co.uk 6 5 2 GO
mordenhallmedicalcentre.co.uk 20 3 23 GO
mordenhall.co.uk 0 0 0 GO
mordenhaikupoetry.blogspot.com 0 4 9 GO
mordenguitarlessons.ca 6 6 15 GO
mordenfloralscents.com 0 0 0 GO
mordenfitness.com 0 4 3 GO
mordenemmc.com 0 0 0 GO
mordenconsultants.com 0 0 0 GO
mordencollege.org 0 4 1 GO
mordencollege.co.uk 19 2 14 GO
mordencc.co.uk 0 1 2 GO
mordenart.com 0 0 0 GO
mordenads.com 0 0 0 GO
morden.kr 2 1 21 GO
morden.dk 7 4 5 GO
mordelles-conduite.com 4 13 3 GO
mordell.net 0 0 0 GO
mordel.net 5 1 15 GO
mordel.de 0 0 3 GO
mordekayverigbioyna.net 4 12 16 GO
mordekayverigbioyna.com 0 0 0 GO
mordekayverigbi.com 2 6 8 GO
mordekai.com 0 0 0 GO
mordek.com.au 28 16 14 GO
mordecor.es 22 5 12 GO
mordecki.com 3 5 7 GO
mordechajkapusta.com 10 9 14 GO
mordechaitwersky.com 15 4 10 GO
mordechaiproject.com 0 0 0 GO
mordechaimusic.com 0 0 0 GO
mordechaikedar.com 20 10 44 GO
mordechaihasofer.blogspot.com 10 35 13 GO
mordechaicohen.com 38 14 44 GO
mordechai7215.blogspot.com 10 5 52 GO
mordecaisonmain.com 1 6 3 GO
mordecaicac.org 5 9 23 GO
mordecaibrown.com 4 5 10 GO
mordecai.org 9 7 9 GO
mordecai.com 0 0 0 GO
mordcardi.co.cc 0 0 0 GO
mordbrannmusikk.com 0 0 0 GO
mordazma.com 0 0 0 GO
mordax.nl 0 0 2 GO
mordawski.com.pl 0 0 0 GO
mordawki.ru 0 0 0 GO
mordauntshort.ru 1 3 2 GO
mordauntshort.com 4 8 12 GO
mordauntgroup.com 0 0 0 GO
mordauntchevrolet.com 0 0 0 GO
mordaunt.me.uk 0 9 0 GO
mordaunt.com 0 0 0 GO
mordasini.ch 0 1 0 GO
mordarskilaw.com 7 3 1 GO
mordapreschool.org.uk 0 0 2 GO
mordantorange.com 7 2 10 GO
mordantforum.com 0 2 3 GO
mordantel.com 3 66 11 GO
mordantbelle.com 0 0 0 GO
mordant.livejournal.com 14 3 10 GO
mordant.com 2 2 2 GO
mordanmusic.com 0 0 0 GO
mordanismanlik.com 7 5 11 GO
mordaniinteriors.com 42 17 51 GO
mordancy.org 2 3 1 GO
mordancy.com 2 3 1 GO
mordanandmore.blogspot.com 10 35 13 GO
mordamus.nl 10 5 8 GO
mordamrecords.com 1 3 2 GO
mordamhellweg.de 5 5 8 GO
mordaha.ru 0 0 0 GO
mordagdesign.com 6 8 20 GO
mordaelettronica.it 1 1 2 GO
mordaciousrant.blogspot.com 9 9 13 GO
mordaciousmusings.blogspot.com 10 57 20 GO
mordaciousart.blogspot.com 10 30 15 GO
mordac.org 8 30 15 GO
mordab-group.ir 0 0 0 GO
mordab.org 0 0 0 GO
morda.by 27 4 35 GO
morczinek-werbung.de 3 18 8 GO
morction.com 0 0 0 GO
morctapes.com 5 13 15 GO
morcstars.com 14 6 42 GO
morcs.hu 6 4 5 GO
morcrehab.org 0 0 0 GO
morcredit.com 1 5 4 GO
morcrafthomes.com.au 5 1 8 GO
morcracing.org 0 2 0 GO
morcouture.com 4 2 5 GO
morcotravel.com 2 4 0 GO
morcoteturismo.ch 22 4 24 GO
morcotehotels.com 0 0 0 GO
morcote.ch 3 3 15 GO
morcosmetics.com 0 0 0 GO
morcosins.com 5 4 12 GO
morcosbrothers.tumblr.com 3 34 13 GO
morcos.hu 2 5 0 GO
morcorltd.com 2 6 2 GO
morco-refrigeration.com 0 1 1 GO
morcoproducts.com 0 0 0 GO
morcoproducts.co.uk 2 4 4 GO
morcopolo.blogspot.com 13 12 18 GO
morcook.co.il 6 6 15 GO
morcontrol.com 6 1 12 GO
morconsulting.com 2 4 5 GO
morconstrutora.com.br 14 22 19 GO
morcon-ind.com 0 4 2 GO
morconconstruction.com 7 15 8 GO
morcon.com 7 15 8 GO
morcon.co.uk 10 10 12 GO
morcompost.com 1 3 1 GO
morcomonline.com 2 1 5 GO
morcomnv.com 2 3 3 GO
morcomhomes.com 27 5 48 GO
morcombetravel.com 27 4 15 GO
morcombe.net 0 1 0 GO
morcom.com 15 2 19 GO
morcoline.com 6 6 12 GO
morcogeological.com 0 0 0 GO
morcofab.com 0 2 2 GO
morco-cpa.com 0 2 0 GO
morcoblinds.co.uk 3 5 7 GO
morcobattery.com 7 15 20 GO
morco.uk.com 2 3 12 GO
morco.com.au 20 19 28 GO
mor-co.com 3 7 2 GO
morco.com 0 2 0 GO
morcmtb.org 29 4 13 GO
morcmtb.com 26 12 25 GO
mor-club.ru 3 1 5 GO
mor-clinic.com 25 19 22 GO
morclinic.com 4 5 14 GO
morclean.com 31 35 36 GO
morclean.co.uk 5 2 13 GO
morclan.cz 29 5 33 GO
morckfamilylaw.com 7 3 3 GO
morckcc.com 0 0 0 GO
morcinc.org 3 5 3 GO
morcinc.net 0 0 0 GO
morcin.es 2 2 2 GO
morcin.com 2 2 2 GO
morcillasramiro.com 27 14 29 GO
morcillaslaribera.com 0 0 0 GO
morcilladevillada.com 43 19 46 GO
morcilladesotopalacios.es 7 8 8 GO
morciaux.be 19 2 11 GO
morciatka.sk 21 6 22 GO
morcianofiere.it 0 0 0 GO
morcia.tumblr.com 7 36 11 GO
morchu.com 4 5 24 GO
morchowerlaw.com 0 0 0 GO
morchomecare.org 3 5 9 GO
morch-guitars.dk 13 5 18 GO
morcher.com 12 12 19 GO
morchemist.com 17 6 19 GO
morcheebix.blogspot.com 0 0 0 GO
morcheeba-fan.com 13 2 7 GO
morcheeba.co.uk 0 0 0 GO
mor-charpentier.com 25 6 7 GO
morcha.net 5 6 9 GO
morch.no 27 9 25 GO
morcevnik.cz 0 2 4 GO
morces.com 4 9 12 GO
morcenter.com 0 0 0 GO
morcelliimoveis.com.br 14 8 20 GO
morcelliana.it 2 2 4 GO
morcelliana.com 0 0 0 GO
morcellement.com 4 3 6 GO
morcellatorandcancer.com 0 0 0 GO
morcelivideo.com.br 0 0 0 GO
morcegaofm.com.br 16 9 35 GO
morcegando.info 0 0 0 GO
morceauxdesucre.fr 29 12 27 GO
morceauxdeciel.com 2 13 0 GO
morce.net 8 6 4 GO
morcd.org 0 0 0 GO
morccreations.com 0 0 0 GO
morcavon.com 21 13 26 GO
morcato.com 5 4 6 GO
morcati.org.tr 13 6 19 GO
morcatanauteku.cz 30 5 33 GO
morcarter.blogspot.com 11 7 18 GO
morcareathome.com 0 0 0 GO
morcare.co.uk 0 0 0 GO
morcapadvisors.com 0 0 0 GO
morcanstudios.com 30 4 24 GO
morcandirectmississauga.com 0 0 0 GO
morcandirectcanada.com 26 25 37 GO
morcandirect.com 26 25 37 GO
morcanbooksandfilms.com 23 21 37 GO
morcan.co.uk 6 7 8 GO
morcan.ca 14 4 15 GO
morcamtb.org 2 10 2 GO
morcadde.net 0 0 0 GO
morcadde.com 0 2 3 GO
morca.info 0 0 0 GO
morca.com.ve 4 2 15 GO
morca.com 0 0 0 GO
morca.cc 0 0 0 GO
morc.info 0 0 0 GO
morc.cz 2 3 0 GO
morbyphotography.com 36 12 31 GO
morbylanga-bostad.se 17 7 18 GO
morbylanga.se 5 13 7 GO
morbydentalgroup.se 26 15 20 GO
morby.us 0 4 3 GO
morby.net 0 0 0 GO
morbus-wilson.de 1 6 2 GO
morbusreiter.de 7 7 9 GO
morbus-pompe.info 0 0 0 GO
morbus-perthes.de 3 10 1 GO
morbusparkinson.de 5 14 12 GO
morbusinstructus.com 0 0 0 GO
morbus-crohn-colitis-ulcerosa.de 3 0 4 GO
morbus-crohn-aktuell.de 10 18 15 GO
morbuscrohn.no 37 27 44 GO
morbus-canavan.com 1 5 2 GO
morbus-behcet.org 2 9 2 GO
morbusbechterew.de 18 25 26 GO
morbusbasedow.de 8 5 2 GO
morbus-alzheimer.de 0 3 0 GO
morburn-music.com 0 0 0 GO
mor-brothers.com 1 3 7 GO
morbros.com 4 3 4 GO
morbroproductions.com 0 1 0 GO
morbrook.org 0 0 0 GO
morbridgeinternational.com 1 4 6 GO
morbrewing.co.uk 0 2 0 GO
morbreizhimmo.com 1 3 0 GO
morboymambo.com 3 16 10 GO
morboygore.com 1 3 9 GO
morboxas.es 2 12 1 GO
morbowebcams.com 3 7 1 GO
morbotubexxx.com 0 0 0 GO
morbotube.net 1 3 9 GO
morbotienda.com 1 0 1 GO
morbosometal.net 0 0 0 GO
morbosas.com 7 2 6 GO
morbonoticias.com 38 19 50 GO
morbomodelospics.com 12 16 14 GO
morbocams.com 9 16 10 GO
morboamateurpics.com 13 6 13 GO
morbo.org 10 7 12 GO
morbling.com 6 13 18 GO
morbleu.com 16 5 23 GO
morblans.com 0 1 0 GO
morbiz.com 13 3 14 GO
morbiwalas.com 8 16 3 GO
morbiustattoo.com.br 17 4 53 GO
morbiusjkromwell.wordpress.com 20 20 23 GO
morbiusglass.blogspot.com 9 35 24 GO
morbitstech.com 40 17 40 GO
morbitilesco.com 0 0 0 GO
morbistenza.it 2 3 17 GO
morbisoft.com 5 4 13 GO
morbipage.com 2 5 11 GO
morbionline.com 0 0 0 GO
morbin.org 18 8 12 GO
morbilive.com 0 0 0 GO
morbiimoveis.com.br 2 4 4 GO
morbihan-way.fr 5 4 7 GO
morbihan-tourism.co.uk 2 9 10 GO
morbihan-sud.com 4 6 17 GO
morbihan-quiberon-bays.com 0 2 3 GO
morbihan-pro.com 31 19 32 GO
morbihan-emploi.fr 0 0 0 GO
morbihanbrittany.com 0 0 0 GO
morbihan.gouv.fr 13 7 13 GO
morbihan.fr 13 12 32 GO
morbihan.com 9 14 26 GO
morbigband.org 1 2 0 GO
morbiflex.it 3 9 15 GO
morbier.fr 9 6 11 GO
morbielegance.in 4 1 4 GO
morbielegance.com 12 5 19 GO
morbie.com 23 22 50 GO
morbidwrath.com 0 0 0 GO
morbidvisionstamp.com 0 3 0 GO
morbid-visions.com 11 2 9 GO
morbidvisionfilms.com 0 0 0 GO
morbidvision.com 0 0 0 GO
morbidunicorn.blogspot.com 0 0 0 GO
morbidtube.com 0 2 1 GO
morbidtendencies.com 0 0 0 GO
morbidtattoo.com 23 13 35 GO
morbidstix.com 28 6 49 GO
morbid-sakura.net 1 5 0 GO
morbidsaint.com 1 6 7 GO
morbidrupture.blogspot.com 10 53 13 GO
morbid-romantic.livejournal.com 17 3 10 GO
morbid-rodz.com 0 0 0 GO
morbidpoetry.de 1 4 0 GO
morbidoutlook.com 0 1 0 GO
morbidoptimism.com 19 4 17 GO
morbidofest.com 29 11 27 GO
morbidobesitytreatment.info 0 0 0 GO
morbidobesitysolutions.com 0 0 0 GO
morbid-obesity-help.com 0 0 0 GO
morbidobesitybmi.com 0 0 0 GO
morbid-obesity.org 0 0 0 GO
morbid-obesity.info 18 25 51 GO
morbidobesity.com 0 0 0 GO
morbido.net 1 7 6 GO
morbidnewjersey.com 12 4 7 GO
morbidnessteer.co.cc 0 0 0 GO
morbidmusings.wordpress.com 20 22 18 GO
morbidmusik.blogspot.com 11 7 17 GO
morbidmusic.com 1 3 1 GO
morbidmuch.com 49 14 16 GO
morbidmtb.com 0 2 0 GO
morbidmountain.com 11 9 4 GO
morbidmoonrecords.com 0 2 0 GO
morbidmonster.com 0 6 0 GO
morbidmodelsagency.com 0 0 0 GO
morbid-model.livejournal.com 15 3 10 GO
morbidmirror.com 16 24 26 GO
morbidmelodyx.livejournal.com 16 3 10 GO
morbidmayflowers.wordpress.com 23 20 19 GO
morbidmastering.com 0 0 0 GO
morbidmask.co.uk 3 6 5 GO
morbidlywrong.com 1 0 0 GO
morbidlyamusingvideos.com 0 0 0 GO
morbidlyamusing.com 0 0 0 GO
morbidloren.livejournal.com 17 3 10 GO
morbidirectory.com 12 16 5 GO
morbidinterest.com 0 0 0 GO
morbidholiday.com 10 8 18 GO
morbidgod.blogspot.com 11 31 13 GO
morbidglamour.tumblr.com 0 0 0 GO
morbidgeneration.de 3 16 3 GO
morbidgames.com 18 14 21 GO
morbidfrog.livejournal.com 14 4 9 GO
morbidfrank.blogspot.com 11 14 23 GO
morbidfeather.livejournal.com 17 3 10 GO
morbid-fascination.blogspot.com 8 2 11 GO
morbidfactdujour.com 16 3 8 GO
morbidenterprises.com 3 9 11 GO
morbidemozioni.it 1 3 11 GO
morbidementia.com 17 4 7 GO
morbidellifilm.com 7 15 8 GO
morbideidee.com 31 11 55 GO
morbideidee.blogspot.com 12 42 37 GO
morbid-curious.livejournal.com 13 4 10 GO
morbid-curiosity.com 0 2 0 GO
morbidcuriositease.com 23 5 14 GO
morbidcircus.tumblr.com 7 40 13 GO
morbid-butterfly.tumblr.com 5 59 16 GO
morbidart-tattoo.ch 0 0 0 GO
morbidart.livejournal.com 13 4 10 GO
morbidart.com 0 13 1 GO
morbidangel.net 0 0 0 GO
morbidangel.com 3 18 5 GO
morbidanatomymuseum.org 27 7 17 GO
morbidanatomy.com 17 3 15 GO
morbid92663.wordpress.com 20 20 23 GO
morbid713.com 0 0 0 GO
mor-bid.com 13 1 6 GO
morbicity.com 0 0 0 GO
morbiceramicindustry.com 12 20 22 GO
mor-biber.net 0 0 0 GO
morbiber.com 0 0 0 GO
morbiato.it 11 6 9 GO
morbi.com.tr 6 26 14 GO
morbhead.blogspot.com 11 9 13 GO
morbeyaz.org 25 10 27 GO
morbeyaz.net 3 7 13 GO
morbeverage.com 0 0 0 GO
morbern.com 10 5 6 GO
morbermarketing.com 26 5 20 GO
morberhighlife.blogspot.com 7 2 7 GO
morberg.com 0 1 1 GO
morbenisaf.co.uk 15 10 12 GO
morbene.com.br 9 22 9 GO
morbela.ee 2 3 1 GO
morbel.co.nz 0 0 0 GO
morbegnoonline.com 0 0 0 GO
morbegnoincantina.it 29 18 38 GO
morbegno.gov.it 4 2 10 GO
morbecque.fr 0 2 0 GO
morbeck.tv 0 0 0 GO
morbeck.blogspot.com 11 81 20 GO
morbean.com 13 7 24 GO
morbazogaytube.net 24 15 25 GO
morbat.com 24 3 23 GO
morbaseliosyeldho.com 0 0 0 GO
morbark5600.com 0 0 0 GO
morbark.net 27 21 31 GO
morbark.com 27 21 31 GO
morbar.net 0 0 0 GO
morbar.com 0 2 1 GO
morbaine.co.uk 34 4 22 GO
morbai.com 1 2 2 GO
morba.ca 1 2 0 GO
morb7.net 0 1 0 GO
morb7.com 27 3 36 GO
morb.wordpress.com 23 20 19 GO
morb.ru 9 5 6 GO
morazzini.livejournal.com 17 3 10 GO
morazen.tumblr.com 0 0 0 GO
moraz.fr 12 7 26 GO
moraz.co.il 0 0 0 GO
moraywebsolutions.com 12 3 11 GO
morayways.org.uk 1 4 4 GO
moraywastebusters.org 14 6 6 GO
morayvillagehalls.org.uk 1 12 7 GO
morayunison.com 14 2 8 GO
moray-tourism.info 0 0 0 GO
moraytints.com 4 4 6 GO
moraytaskforce.com 1 6 9 GO
moraystorage.co.uk 3 1 1 GO
moraysteinerschool.org 8 18 8 GO
morayspeyside.com 37 11 42 GO
moraysnp.org 4 2 4 GO
morayskitchen.wordpress.com 26 24 24 GO
moraysjewelers.com 4 11 41 GO
moraysjewelers.blogspot.com 10 33 11 GO
moraysecurity.com 4 4 14 GO
morayscuba.com 0 2 0 GO
morayscouts.org.uk 15 2 8 GO
morayrosscaithness.blogspot.com 10 41 13 GO
morayrfc.co.uk 1 2 11 GO
morayproperty.co.uk 0 0 0 GO
moraypresbytery.org.uk 7 5 7 GO
morayplace.co.uk 11 7 15 GO
moray-piano-competition.co.uk 0 0 0 GO
moraypark.com 0 4 3 GO
moraymusic.com 7 15 8 GO
moraymountainbikeclub.co.uk 2 3 2 GO
moraymotormuseum.org 14 6 24 GO
moraymo.us 0 0 0 GO
moraymarathon.com 14 4 6 GO
morayleisurecentreelgin.co.uk 0 0 0 GO
moray-leisure-centre.co.uk 15 7 6 GO
morayland.com 0 0 0 GO
morayjobsonline.co.uk 0 0 0 GO
morayjazzclub.co.uk 0 8 9 GO
morayhydrotherapypool.co.uk 9 4 9 GO
morayhols.co.uk 2 8 8 GO
morayholidays.co.uk 2 10 12 GO
moraygrant.com 0 4 2 GO
moraygolf.co.uk 9 2 14 GO
moraygarcia.com 0 0 0 GO
moraygamejam.com 1 2 6 GO
moraygallery.com 6 4 5 GO
morayfundingsupport.org 0 0 0 GO
morayfirth-partnership.org 5 1 10 GO
morayfirthlive.com 0 0 0 GO
morayfirthcamperandcaravanhire.co.uk 21 21 37 GO
morayfieldvet.com.au 0 0 0 GO
morayfieldshoppingcentre.com.au 2 4 16 GO
morayestates.com 4 11 4 GO
morayeels.com 4 9 9 GO
morayeel.info 0 0 0 GO
moraydivelights.com 0 0 0 GO
moraydivegear.com 0 0 0 GO
moraydance.co.uk 6 12 7 GO
moraydaleguesthouse.com 15 9 23 GO
moray-cottages.com 3 3 3 GO
morayconnections.com 15 3 16 GO
moraycoastvetgroup.co.uk 3 3 8 GO
moraycoastmcc.org.uk 3 10 6 GO
moraycoastcottages.com 18 10 26 GO
moraycoastcottage.co.uk 2 5 0 GO
morayclocks.co.uk 2 3 3 GO
morayclaims.co.uk 32 13 36 GO
moraychamber.co.uk 15 8 18 GO
moraycc.org 0 0 0 GO
moraycashmere.com 6 3 12 GO
moraycarers.co.uk 0 0 0 GO
moraybeedinosaurs.co.uk 5 20 12 GO
morayati.com 16 4 13 GO
morayaraujo.com.ar 0 1 0 GO
morayandnairnfhs.co.uk 1 8 0 GO
morayallan.com 1 0 0 GO
morayaglobal.com 11 4 7 GO
morayabay.com 10 3 24 GO
moraya.net 15 3 6 GO
moray.org 0 0 0 GO
moray.com.au 14 2 14 GO
moray.ac.uk 4 0 16 GO
morax.gr 2 4 2 GO
morawskipiotr.pl 11 11 17 GO
morawski.eu 3 5 15 GO
morawski.com.pl 2 1 0 GO
morawski.com 3 4 3 GO
morawska.cz 2 2 0 GO
morawk.com 0 0 0 GO
morawino-stamps.com 3 11 10 GO
morawin.jp 0 0 0 GO
morawik.com 0 0 0 GO
morawiczlaw.com 7 25 14 GO
morawicar.pl 2 4 2 GO
morawica.net 27 4 18 GO
morawica.com.pl 5 2 10 GO
morawetz.info 3 6 5 GO
morawel.com 0 0 0 GO
morawek.at 1 0 0 GO
morawealth.com 32 4 71 GO
moraware.net 19 4 20 GO
moraware.com 19 4 20 GO
morawalogistik.com 5 6 20 GO
morawa-buchundmedien.at 5 4 21 GO
morawa.org 11 2 26 GO
morawa.at 5 4 21 GO
moravskyzizkov.cz 8 9 10 GO
moravskypisek.cz 5 2 19 GO
moravskypatriot.eu 2 5 0 GO
moravskykras.net 9 6 16 GO
moravskykarlov.cz 7 7 21 GO
moravskykalendar.cz 5 34 15 GO
moravskyautoland.cz 1 6 2 GO
moravsko-slezsky-kraj.cz 12 12 2 GO
moravskoslezskenovinky.cz 6 14 22 GO
moravske-toplice.si 14 9 23 GO
moravskereality.cz 28 23 60 GO
moravskelieskove.sk 0 0 0 GO
moravskekninice.cz 6 3 11 GO
moravskehrady.cz 1 5 5 GO
moravskehospodarstvi.cz 26 31 29 GO
moravskedivadlo.cz 9 5 20 GO
moravskazahrada.cz 22 23 33 GO
moravskavyskarskatour.cz 0 0 0 GO
moravska-vlajka.eu 13 3 17 GO
moravska-vinoteka.cz 12 3 18 GO
moravskatrebova.cz 5 14 10 GO
moravska-stezka.cz 9 9 12 GO
moravskasipka.cz 14 3 6 GO
moravskarestaurace.cz 3 6 3 GO
moravska-pivnice.cz 0 5 0 GO
moravskaoaza.cz 4 6 13 GO
moravska-lekarna.cz 6 10 9 GO
moravskakuchyne.eu 3 7 2 GO
moravska-galerie.cz 3 4 11 GO
moravskabouda.cz 6 7 11 GO
moravostav.cz 14 9 9 GO
moravoseed.cz 1 2 2 GO
moravola.com 5 5 14 GO
moravkova.com 4 7 10 GO
moravkaplzen.cz 7 7 16 GO
moravka.rs 3 6 7 GO
moravka.eu 21 2 34 GO
moravita.com 20 5 33 GO
moravio.cz 4 18 7 GO
moravio.com 4 18 7 GO
moravidy.com 0 0 0 GO
moraviaww.com 4 7 12 GO
moraviaworldwide.com 4 7 12 GO
moraviawood.cz 15 10 7 GO
moraviawines.com 3 3 11 GO
moraviavitis.cz 0 1 1 GO
moravia-verlag.de 1 1 0 GO
moravia-tuning.cz 1 7 5 GO
moraviatourism.cz 3 16 3 GO
moraviation.com 0 3 2 GO
moraviatex.cz 13 5 25 GO
moraviatel.cz 24 3 23 GO
moraviatactical.cz 10 16 16 GO
moraviasmallmart.com 0 0 0 GO
moraviaschool.org 4 3 4 GO
moraviarest.cz 5 9 12 GO
moraviarcracing.cz 6 9 9 GO
moraviapropag.cz 5 8 17 GO
moraviapress.cz 14 12 20 GO
moraviapark.com 20 4 30 GO
moravianzta.com 0 0 0 GO
moravianyouth.org 0 0 0 GO
moraviany.com 12 6 17 GO
moravianwomensconference.org 26 22 21 GO
moravianwest.org 2 5 7 GO
moravianvillage.com 31 15 30 GO
moraviantrombonechoir.org 32 19 26 GO
moraviantoys.com 0 1 0 GO
moraviansynod.wordpress.com 20 20 17 GO
moravianstars.com 0 9 0 GO
moravianstarlights.com 9 6 2 GO
moravianstarlady.com 0 0 0 GO
moravianstar.com 2 2 6 GO
moravianseminary.edu 27 7 13 GO
moravianschoolvi.org 0 0 0 GO
moravians.org 0 0 0 GO
moravians.net 11 3 17 GO
moraviannd.com 3 5 9 GO
moravianmusicfestival.org 21 7 21 GO
moravianmusic.org 23 11 25 GO
moravianmusic.blogspot.com 10 33 11 GO
moravianmission.org 16 7 8 GO
moravianmasterclass.com 4 13 3 GO
moravianmapc.wordpress.com 21 22 18 GO
moravianmanor.org 36 16 42 GO
moravianlions.com 0 0 0 GO
moravianlarp.cz 30 20 45 GO
moravianhouseantiques.com 3 4 1 GO
moravianhouse.org 18 14 25 GO
moravianhistoricalsociety.org 0 1 0 GO
moravianhallcorpuschristi.com 14 3 6 GO
moravianflorist.com 10 22 27 GO
moravianfamily.wordpress.com 22 20 24 GO
moravianfallsart.com 0 0 0 GO
moravianfalls.org 1 3 0 GO
moravianfalls.info 0 0 0 GO
moravianculturalsociety.org 7 19 8 GO
moraviancookies.com 0 2 0 GO
moravian-connection.com 0 1 0 GO
moravianconferences.org 16 2 12 GO
moravianclub.com 0 1 3 GO
moravianchurcharchives.org 21 1 22 GO
moravian-chess.cz 3 3 5 GO
moraviancemetery.com 0 1 1 GO
moravianbrass.co.za 1 5 10 GO
moravianbookshop.com 2 2 6 GO
moravianbookandgiftshop.com 0 0 0 GO
moravianbookandgift.org 0 0 0 GO
moravianboardofce.org 0 0 0 GO
moravian-biotech.com 0 6 0 GO
moravianarchives.org 18 3 32 GO
moravianacademy.org 5 5 5 GO
moravian.org.uk 15 6 19 GO
moravian.org 20 8 52 GO
moravian.mobi 0 0 0 GO
moravian.edu 6 8 9 GO
moravian.com 12 1 15 GO
moravian.ca 0 2 0 GO
moraviamule.com 0 0 0 GO
moravia-motors.ru 13 5 38 GO
moraviamohawks.com 0 0 0 GO
moraviamodels.cz 0 0 0 GO
moravia-microsystems.com 7 4 21 GO
moraviaman.cz 38 7 41 GO
moraviamagna.cz 1 22 0 GO
moravialumber.com 0 0 0 GO
moravialov.cz 2 1 2 GO
moraviajeans.com.ar 5 1 7 GO
moravia-it.com 4 7 12 GO
moraviaia.com 2 3 10 GO
moraviahealth.com 13 4 14 GO
moravia-hasso.cz 3 7 3 GO
moraviagroup.com 3 3 6 GO
moraviafinish.cz 3 5 10 GO
moravia-europe.eu 2 3 4 GO
moraviadogschool.cz 17 7 12 GO
moraviadetect.cz 6 9 9 GO
moraviadent.cz 5 6 7 GO
moraviacup.cz 6 9 5 GO
moraviacsd.com 5 6 23 GO
moravia-contact.cz 0 2 0 GO
moravia-consulting.com 2 3 4 GO
moraviaconsultants.com 1 2 2 GO
moravia-center.ru 0 0 0 GO
moraviacatclub.eu 4 7 13 GO
moraviacapital.com 8 12 6 GO
moraviabluedevils.com 0 0 0 GO
moravia-akademie.de 20 15 12 GO
moravia.de 5 14 11 GO
moravia.com.tr 3 1 9 GO
moravia.com.py 7 10 14 GO
moravia.com 4 7 12 GO
moravia.co.uk 5 14 10 GO
moravelaspizza.com 18 6 22 GO
moravel.cz 8 10 10 GO
moraveksoccerschool.com 0 4 2 GO
moravekroofing.com 22 13 16 GO
moravek-okna.cz 0 0 0 GO
moravekcz.cz 7 6 8 GO
moravek.net 0 0 0 GO
moravek.com 21 4 13 GO
moraveji.org 0 0 0 GO
moravee-agency.com 0 0 0 GO
moravecwaterwells.com 9 5 17 GO
moravec-tejping.cz 26 12 32 GO
moravecslaw.com 8 21 8 GO
moravec-hicks.in 0 0 0 GO
moravec-hicks.com 0 0 0 GO
moravecglobal.com GO
moravecfsc.com 0 3 2 GO
moravecfinancial.com 5 14 22 GO
moravecdent.cz 13 3 18 GO
moravec.net 30 12 28 GO
moravec.at 5 10 7 GO
moravcsikalapitvany.hu 15 3 24 GO
moravcsik.hu 1 3 5 GO
moravcikpigeon.sk 1 1 1 GO
moravcikovavina.cz 2 5 5 GO
moravcik.com 12 8 21 GO
moravce.sk 5 9 7 GO
moravce.si 3 7 6 GO
moravatour.cz 7 6 16 GO
moravasolod.ru 4 8 13 GO
moravarestaurant.com 0 0 0 GO
moravapenzion.cz 0 0 0 GO
moravany.sk 5 5 22 GO
moravanlednice.cz 1 5 9 GO
moravamotors.cz 8 6 11 GO
moravamebel.ru 0 0 0 GO
moravalleyranchsupply.com 2 2 9 GO
moravalley.com 0 2 0 GO
morava-live.cz 14 5 10 GO
moravaglassstudios.com 3 3 11 GO
moravagarden.com 18 2 14 GO
moravacup.cz 11 2 17 GO
moravacamp.cz 15 37 18 GO
moravabooks.com 9 6 6 GO
moravabeer.ru 0 0 0 GO
morava.de 0 0 0 GO
morav.net 1 3 12 GO
mora-uno.net 0 0 0 GO
moratus.hu 3 1 4 GO
moratto.it 14 3 10 GO
moratto.com.ar 22 3 29 GO
morattiturismo.com.br 0 0 0 GO
moratti.ru 3 4 6 GO
moratti.co.nz 25 9 23 GO
morattabkhodro.com 0 6 0 GO
morattab.ir 0 0 0 GO
moratta.com.br 0 0 0 GO
moratsbakeshop.com 2 7 3 GO
moratrask.se 2 9 4 GO
moratraningscenter.se 37 12 49 GO
moratox.com 11 20 21 GO
moratorium-record.com 0 0 0 GO
moratoriumcampaign.org 9 2 2 GO
moratorget.se 9 16 28 GO
moratoplineboxers.com 3 9 14 GO
mora-top.ru 4 2 10 GO
moratop.cz 0 1 0 GO
moratomotos.com.br 0 0 4 GO
moratomebel.bg 39 17 33 GO
moratojunior.com 5 10 4 GO
morato.jp 3 5 7 GO
morato.it 12 13 23 GO
morato.bg 0 0 0 GO
moratiwa.co.za 0 0 0 GO
moratinsuranceservices.com 0 0 0 GO
morat-institut.de 12 24 2 GO
moratinoslife.blogspot.com 10 41 16 GO
moratiimoveis.com.br 15 13 20 GO
moratic.in 0 0 0 GO
morathauto.com 6 4 10 GO
morath.ch 5 9 13 GO
moratense.com.br 2 3 14 GO
moratelindo.co.id 18 2 46 GO
moratech.com 0 2 0 GO
morata-samantha-fmgroup.com 0 0 0 GO
moratallapetece.com 0 0 0 GO
moratalla-murcia.com 0 2 0 GO
moratalaz.com 4 5 8 GO
morataara.com 4 6 11 GO
morata.fr 0 0 0 GO
morata.com.br 16 3 33 GO
morata.com 9 4 11 GO
morata.be 0 0 0 GO
morasystems.co.tt 0 4 5 GO
moraswines.com 3 6 6 GO
morasurgicalclinic.com 4 3 19 GO
morasurcocafepuro.com 0 0 1 GO
morastylos.com 8 7 23 GO
morastrand.se 19 4 24 GO
morastour.cz 9 5 22 GO
morasta.it 0 1 0 GO
mo-rast.org 10 6 14 GO
morassutti.com 2 5 9 GO
morassociates.com 4 5 14 GO
morassisport.it 7 7 8 GO
morassilone.com 11 2 15 GO
morassacarpet.ir 0 0 0 GO
moraspirit.com 10 10 15 GO
moraspa.it 7 5 14 GO
morasolsuiteshotel.com 3 3 3 GO
morasol-suites.com 0 0 0 GO
morasolhoteles.es 12 14 29 GO
morasolapartments.com 0 0 0 GO
morasmt2.com 0 0 0 GO
morasmodern.com 16 3 12 GO
moraskiclub.org 5 10 21 GO
moraski.com 0 2 3 GO
morasiceuznojma.cz 29 3 40 GO
morashat.com 5 3 8 GO
morashasyllabus.com 2 10 9 GO
morashajps.org.uk 0 1 0 GO
morashagermany.de 0 0 0 GO
morashablog.blogspot.com 9 110 13 GO
morasha.it 0 3 10 GO
mora-service.ru 0 0 0 GO
moraselon.net 0 0 0 GO
morasel.net 4 1 7 GO
mora-scholarship.info 0 0 0 GO
moraschmeats.com 2 2 14 GO
moraschi.com.ar 3 1 9 GO
morascha.ch 1 9 1 GO
morasch.com 24 27 13 GO
morascatomberoma.com 33 17 54 GO
morasarotulos.com 2 1 2 GO
morasalazar.com 35 21 39 GO
moras38.fr 8 6 13 GO
moras.jp 1 4 0 GO
moras.gr 25 3 16 GO
morarusp.com.br 2 21 7 GO
morarunifesp.com.br 2 21 7 GO
morarunicamp.com.br 2 21 7 GO
moraruff.com.br 2 21 7 GO
morartimoveis.com.br 0 0 0 GO
morartdesigns.com 0 0 0 GO
morart.net 2 8 16 GO
morart.com 9 5 4 GO
morar-research.com 1 0 0 GO
morarotulos.com 5 17 6 GO
morarossello.com 5 3 12 GO
moraromagnola.eu 1 1 2 GO
moraroethiopiatour.com 0 0 0 GO
morarocks.com 1 5 0 GO
morarnorio.com 4 22 6 GO
morarnaeuropa.com.br 0 0 0 GO
morarmais.com.br 0 0 1 GO
morarkango.com 20 7 6 GO
morarkallas.com.br 5 8 11 GO
morarjeetextiles.com 1 1 3 GO
morarjee.com 1 1 3 GO
moraritsipanificatie.eu 25 23 26 GO
morarimoveis.net 19 43 27 GO
moraribapu.org 0 1 0 GO
moraribapu.com 0 0 0 GO
morarhotel.co.uk 3 2 7 GO
morarescu.de 2 1 8 GO
morarempoa.com 2 3 5 GO
moraremparis.com 20 12 30 GO
moraremfortaleza.com.br 0 0 0 GO
moraremcampinas.com.br 0 0 0 GO
morare.com.br 4 11 20 GO
morard-taxi.com 2 5 3 GO
morarconsulting.com 0 0 0 GO
morarchitecture.com 6 1 12 GO
morarcherytargets.com 0 0 0 GO
morarbemnorio.com.br 13 3 16 GO
morarbemmogi.com.br 1 12 12 GO
morarbemmg.com 1 3 3 GO
morarbemimoveis.com 5 1 9 GO
morarbemadm.com.br 15 2 31 GO
morarangers.com 0 0 0 GO
morar.net 4 5 0 GO
morar.com 7 7 29 GO
moraquita.com 0 0 0 GO
moraquest.com 4 6 5 GO
moraqueja.com 0 0 0 GO
moraprado.com.ar 3 1 7 GO
moraplast.it 18 5 26 GO
morapiggy.blogspot.com 12 47 15 GO
moraphotography.com 0 0 0 GO
morapel.pl 3 5 13 GO
moraparty.com 10 3 2 GO
moraparken.se 8 6 10 GO
morapaolo.it 26 127 39 GO
morapanty.com 22 8 57 GO
mora-packing.com 10 12 19 GO
moraoutdoor.se 2 6 6 GO
moraotapas.com 7 4 22 GO
mora-of-sweden.co.uk 22 5 51 GO
moraofsweden.co.uk 22 5 51 GO
moranzlawnandgarden.com 17 7 9 GO
moranzapatos.com 0 1 0 GO
moranyachts.net 10 7 21 GO
moranyachts.com 10 7 21 GO
moranwyoming.com 1 6 7 GO
moranwoodworks.com 0 7 1 GO
moranwood.ru 6 4 12 GO
moran-web.net 0 5 1 GO
moranvista.com 5 7 23 GO
moranvilleandassociates.com 1 3 7 GO
moranvigil.com 0 0 0 GO
moranvidal.com 28 5 36 GO
moranusa.com 0 1 0 GO
morantzmusic.com 0 0 0 GO
morantzcabinets.com 3 4 6 GO
morantz.com 24 18 35 GO
morantuswa.com 0 0 0 GO
morantug.com 4 3 10 GO
morants.wordpress.com 22 20 23 GO
morantravel.com 0 0 0 GO
morantravel.co.uk 11 9 15 GO
morantransportation.com 0 0 0 GO
morantoys.co.il 4 5 11 GO
morantowing.com 0 0 0 GO
morantmedia.com 5 4 19 GO
morantheater.org 0 0 0 GO
morantesdds.com 0 3 5 GO
morantes.com 2 19 2 GO
morantenn.com 7 21 12 GO
morantechnology.com 15 18 16 GO
moranteasesores.es 17 20 19 GO
morante.eu 2 1 2 GO
morant.com 0 0 0 GO
moranswoodcomponents.co.uk 0 0 0 GO
moran-survey.com 0 1 0 GO
moransurf.com 0 1 0 GO
moransupply.com 0 2 0 GO
moranstvappliance.com 0 2 1 GO
moranstclairchryslerjeepdodge.com 11 16 61 GO
moranstatepark.com 32 14 21 GO
moranssellsunshine.com 0 0 0 GO
moransrestaurant.com 0 0 0 GO
moranspremium.com 0 0 0 GO
moransoystercottage.com 26 14 74 GO
moransound.com 1 5 9 GO
moransoftasmania.com.au 0 0 0 GO
moransnyc.com 17 5 11 GO
moranshvac.com 26 19 22 GO
moranshomezone.ie 34 5 65 GO
moran-shoes.co.il 5 5 20 GO
moranshipping.com 5 4 15 GO
moranseatinghouse.co.uk 2 1 2 GO
moransaddlery.eu 0 0 0 GO
moransabbah.com 35 9 25 GO
moranrecordings.com 17 2 14 GO
moranrealtyco.com 0 0 0 GO
moranrealty.com 1 3 2 GO
moranprizes.com.au 6 4 21 GO
moranprinting.com 4 4 12 GO
moran-plumbing.com 4 0 6 GO
moranplumbing.co.uk 16 4 13 GO
moranplasticeng.com 4 3 4 GO
moranplant.org 12 16 15 GO
moranpix.com 0 7 7 GO
moranphoto.net 2 4 2 GO
moranperio.com 15 19 15 GO
moranpalmoni.com 19 13 35 GO
moranos.com 0 0 0 GO
moranorthodontics.com 11 5 9 GO
moranorestoration.com 0 3 0 GO
moranorehabofva.com 0 0 0 GO
moranoracing.wordpress.com 22 20 23 GO
moranoracing.com 0 0 0 GO
moran-online.com 0 0 0 GO
moranomyh.com.ar 17 15 19 GO
moranointernational.com 0 0 0 GO
moranogomme.it 6 5 4 GO
moranogelato.com 4 3 18 GO
morano.pl 3 16 15 GO
morano.com.ua 8 4 17 GO
morannorrisfoundation.org 4 4 17 GO
morannon.org 22 10 34 GO
morannes.fr 13 5 15 GO
moranmustangs.org 0 0 0 GO
moran-mountain.co.uk 1 3 8 GO
moranmotorsports.com 42 4 36 GO
moranmotorsports.blogspot.com 10 7 13 GO
moranmotorhomes.com 2 3 8 GO
moranmotorhomes.co.uk 2 3 8 GO
moranmonfort.com 0 0 0 GO
moranmitsubishi.com 13 14 36 GO